Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fgf3 Peptide - C-terminal region

Fgf3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Int2, Fgf3

UniProt

Q8R5L9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fgf3 Rabbit Polyclonal Antibody (orb578384) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_570830

Preservative

Lyophilized powder

AA Sequence

KGRPRRGFKTRRTQKSSLFLPRVLGHKDHEMVRLLQSGQPQAPGEGSQPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transmembrane protein 88B (TMEM88B) (NM_001146685) Human Over-expression Lysate
LY431124 100 µg

Transmembrane protein 88B (TMEM88B) (NM_001146685) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TET2 activation kit by CRISPRa
GA110262 1 Kit

Human TET2 activation kit by CRISPRa

Sign In for Pricing
View Details
Leiomodin 3 (LMOD3) Human Gene Knockout Kit (CRISPR)
KN423251 1 Kit

Leiomodin 3 (LMOD3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p53 (TP53) pSer46 Rabbit Polyclonal Antibody
AP01659PU-N 100 µg

p53 (TP53) pSer46 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
m-Isopropoxyaniline
TRC-I822990-5G 5 g

m-Isopropoxyaniline

Sign In for Pricing
View Details
WWP1 Antibody
KC-2401-01 50 μL

WWP1 Antibody

Sign In for Pricing
View Details