Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF8 Peptide - C-terminal region

FGF8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIGF, HBGF-8, KAL6, MGC149376, FGF-8

UniProt

P55075

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGF8 Rabbit Polyclonal Antibody (orb585559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006110

Preservative

Lyophilized powder

AA Sequence

EGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cux1 shRNA (UAS) - Lentiviral mouseCux1 shRNA (UAS, GFP) (25)
GTR15117644 1 Vial

Lentiviral mouse Cux1 shRNA (UAS) - Lentiviral mouseCux1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TERT, phosphorylated (Ser1125) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (MaxLight 650) discontinued
T2399-25D-ML650 100 µL

TERT, phosphorylated (Ser1125) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Gm15080 3'UTR GFP Stable Cell Line
TU157683 1.0 mL

Gm15080 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RGS20 Antibody
orb680853 100 µL

RGS20 Antibody

Sign In for Pricing
View Details
Nelfb (NM_001107817) Rat Tagged Lenti ORF Clone
RR212089L4 10 µg

Nelfb (NM_001107817) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GBP1P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV762093 1.0 µg DNA

GBP1P1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details