Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF8 Peptide - C-terminal region

FGF8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIGF, HBGF-8, KAL6, MGC149376, FGF-8

UniProt

P55075

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGF8 Rabbit Polyclonal Antibody (orb585559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006110

Preservative

Lyophilized powder

AA Sequence

EGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RET Mouse Monoclonal Antibody [Clone ID: OTI4H3]
TA805744 100 µL

RET Mouse Monoclonal Antibody [Clone ID: OTI4H3]

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Hemopexin (HPX)
MBS2061589-01 0.1 mL

APC-Linked Polyclonal Antibody to Hemopexin (HPX)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Hemopexin (HPX)
MBS2061589-02 0.2 mL

APC-Linked Polyclonal Antibody to Hemopexin (HPX)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Hemopexin (HPX)
MBS2061589-03 0.5 mL

APC-Linked Polyclonal Antibody to Hemopexin (HPX)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Hemopexin (HPX)
MBS2061589-04 1 mL

APC-Linked Polyclonal Antibody to Hemopexin (HPX)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Hemopexin (HPX)
MBS2061589-05 5 mL

APC-Linked Polyclonal Antibody to Hemopexin (HPX)

Sign In for Pricing
View Details