Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFBP2 Peptide - C-terminal region

FGFBP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HBP17RP, KSP37

UniProt

Q9BYJ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGFBP2 Rabbit Polyclonal Antibody (orb326354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114156

Preservative

Lyophilized powder

AA Sequence

LGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RNF214 Pre-designed siRNA Set A
SI013886A 1 Each

Human RNF214 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Protein disulfide-isomerase A2 (PDIA2) Mouse ELISA Kit
G2682 96 Tests

Protein disulfide-isomerase A2 (PDIA2) Mouse ELISA Kit

Sign In for Pricing
View Details
PTCHD1 Protein Vector (Mouse) (pPB-C-His)
PV220602 500 ng

PTCHD1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
HCG_1657980, ID (hCG_1657980) (Azide free) (HRP) discontinued
036459-HRP 200 µL

HCG_1657980, ID (hCG_1657980) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Human TNFRSF8 protein, His-tag, GMP Grade
TNFRSF8-567THP 10 µg

Recombinant Human TNFRSF8 protein, His-tag, GMP Grade

Sign In for Pricing
View Details
KCNH3 Antibody
GWB-MM047B 50 µg

KCNH3 Antibody

Sign In for Pricing
View Details