Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFBP2 Peptide - C-terminal region

FGFBP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HBP17RP, KSP37

UniProt

Q9BYJ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGFBP2 Rabbit Polyclonal Antibody (orb326354) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114156

Preservative

Lyophilized powder

AA Sequence

LGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD36 Antibody Picoband®, Carrier-free
A01189-1-carrier-free 100 µg/Vial

Anti-CD36 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
hCG beta 2 Antibody FITC-Conjugated
MBS541249-01 0.1 mg

hCG beta 2 Antibody FITC-Conjugated

Sign In for Pricing
View Details
hCG beta 2 Antibody FITC-Conjugated
MBS541249-02 5x 0.1 mg

hCG beta 2 Antibody FITC-Conjugated

Sign In for Pricing
View Details
Dexras1 CRISPR Activation Plasmid (h2)
sc-412234-ACT-2 20 µg

Dexras1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
2-Chloro-1- (1H-indol-2-yl) ethan-1-one
LBA70995-01 50 mg

2-Chloro-1- (1H-indol-2-yl) ethan-1-one

Sign In for Pricing
View Details
2-Chloro-1- (1H-indol-2-yl) ethan-1-one
LBA70995-02 0.5 g

2-Chloro-1- (1H-indol-2-yl) ethan-1-one

Sign In for Pricing
View Details