Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR2 Peptide - C-terminal region

FGFR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BEK, BFR-1, CD332, CEK3, CFD1, ECT1, FLJ98662, JWS, K-SAM, KGFR, TK14, TK25

UniProt

P21802

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGFR2 Rabbit Polyclonal Antibody (orb584555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075259

Preservative

Lyophilized powder

AA Sequence

KPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LAMB3 Protein, N-His
YHG64103 100 μg

Recombinant Human LAMB3 Protein, N-His

Sign In for Pricing
View Details
SLC19A2 Antibody
MBS7108079-01 0.05 mg

SLC19A2 Antibody

Sign In for Pricing
View Details
SLC19A2 Antibody
MBS7108079-02 0.1 mg

SLC19A2 Antibody

Sign In for Pricing
View Details
SLC19A2 Antibody
MBS7108079-03 5x 0.1 mg

SLC19A2 Antibody

Sign In for Pricing
View Details
Atg4b sgRNA CRISPR Lentivector set (Rat)
K7142301 3x 1.0 µg

Atg4b sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
DNAJC15 Overexpression Lysate (Native) - (Dry Ice)
NBL1-09946 0.1 mg

DNAJC15 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details