Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR2 Peptide - C-terminal region

FGFR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BEK, BFR-1, CD332, CEK3, CFD1, ECT1, FLJ98662, JWS, K-SAM, KGFR, TK14, TK25

UniProt

P21802

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGFR2 Rabbit Polyclonal Antibody (orb584555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075259

Preservative

Lyophilized powder

AA Sequence

KPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CCDC89 Antibody
MBS8323723-01 0.03 mL

Anti-CCDC89 Antibody

Sign In for Pricing
View Details
Anti-CCDC89 Antibody
MBS8323723-02 0.05 mL

Anti-CCDC89 Antibody

Sign In for Pricing
View Details
Anti-CCDC89 Antibody
MBS8323723-03 0.1 mL

Anti-CCDC89 Antibody

Sign In for Pricing
View Details
Anti-CCDC89 Antibody
MBS8323723-04 0.2 mL

Anti-CCDC89 Antibody

Sign In for Pricing
View Details
Anti-CCDC89 Antibody
MBS8323723-05 5x 0.2 mL

Anti-CCDC89 Antibody

Sign In for Pricing
View Details
PAH Std Fluoranthene 1000ug/mL in DCM - 1ML
REPAH158 1 mL

PAH Std Fluoranthene 1000ug/mL in DCM - 1ML

Sign In for Pricing
View Details