FGFR2 Peptide - middle region
FGFR2 Peptide - middle region
Product Specifications
Product Name Alternative
BEK, BFR-1, CD332, CEK3, CFD1, ECT1, FLJ98662, JWS, K-SAM, KGFR, TK14, TK25
UniProt
P21802
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FGFR2 Rabbit Polyclonal Antibody (orb584556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_075259
Preservative
Lyophilized powder
AA Sequence
KHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICK
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15170915 1 Vial
Lentiviral mouse Kif5a shRNA (UAS) - Lentiviral mouse Kif5a shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details MBS7146180 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) MFDX2 Polyclonal Antibody
Sign In for Pricing
View Details E28PE0491 100 µL
GSTT2 (Glutathione S Transferase theta 2) (9F2) Mouse Monoclonal antibody
Sign In for Pricing
View Details 
MBS9935298-01 48 Well
Mouse Transcription Elongation Regulator 1 (TCERG1) ELISA Kit
Sign In for Pricing
View Details