Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHIT Peptide - middle region

FHIT Peptide - middle region

Product Specifications

Product Name Alternative

AP3Aase, FRA3B

UniProt

P49789

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FHIT Rabbit Polyclonal Antibody (orb581286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002003

Preservative

Lyophilized powder

AA Sequence

VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTN3A1 Double Nickase Plasmid (h2)
sc-404202-NIC-2 20 µg

BTN3A1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Anti-POTE-8 antibody
STJ95189 200 µl

Anti-POTE-8 antibody

Sign In for Pricing
View Details
TUB antibody
70R-21054 50 ul

TUB antibody

Sign In for Pricing
View Details
Mouse Mpc2 activation kit by CRISPRa
GA208530 1 Kit

Mouse Mpc2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Dog Prealbumin (PALB)
RPU44161-01 50 µg

Recombinant Dog Prealbumin (PALB)

Sign In for Pricing
View Details
Recombinant Dog Prealbumin (PALB)
RPU44161-02 100 µg

Recombinant Dog Prealbumin (PALB)

Sign In for Pricing
View Details