Fkrp Peptide - C-terminal region
Fkrp Peptide - C-terminal region
Product Specifications
Product Name Alternative
A830029B19Rik, AI842067, AI847300, LGMD1I, MDC1C
UniProt
Q8CG64
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fkrp Rabbit Polyclonal Antibody (orb579333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775606
Preservative
Lyophilized powder
AA Sequence
FPEHFLQPLVPLPFAGFMAQAPNNYRRFLELKFGPGVIENPEYPNPALLS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680029-100 1x 100 µL
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941541-500 1x 500 µL
Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040900-100 1x 100 µL
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470836-100 1x 100 µL
Cytokeratin 18 (KRT18/836), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details