Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLCN Peptide - N-terminal region

FLCN Peptide - N-terminal region

Product Specifications

Product Name Alternative

BHD, DKFZp547A118, FLCL, FLJ45004, FLJ99377, MGC17998, MGC23445

UniProt

Q8NFG4

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLCN Rabbit Polyclonal Antibody (orb585045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659434

Preservative

Lyophilized powder

AA Sequence

EEGGIQMNSRMRAHSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700028K03Rik Mouse Gene Knockout Kit (CRISPR)
KN500124 1 Kit

1700028K03Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Saponin Microplate Assay Kit
RDSM217 100 Assays

Saponin Microplate Assay Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708075 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Fast Plus EvaGreen® qPCR Master Mix with low Rox (trial size, 100 rxn)
#31014-T 1x 1 mL

Fast Plus EvaGreen® qPCR Master Mix with low Rox (trial size, 100 rxn)

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb1801), CF594 conjugate, 0.1mg/mL
BNC941916-100 1x 100 µL

P53 Tumor Suppressor Protein (PAb1801), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chicken Osteocalcin (OC) ELISA Kit
RD-OC-Ch-01 96 Tests

Chicken Osteocalcin (OC) ELISA Kit

Sign In for Pricing
View Details