Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLCN Peptide - N-terminal region

FLCN Peptide - N-terminal region

Product Specifications

Product Name Alternative

BHD, DKFZp547A118, FLCL, FLJ45004, FLJ99377, MGC17998, MGC23445

UniProt

Q8NFG4

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLCN Rabbit Polyclonal Antibody (orb585045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659434

Preservative

Lyophilized powder

AA Sequence

EEGGIQMNSRMRAHSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cxcr3 Mouse Gene Knockout Kit (CRISPR)
KN304051LP 1 Kit

Cxcr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CTRB2 (NM_001025200) Human Over-expression Lysate
LC422479 20 µg

CTRB2 (NM_001025200) Human Over-expression Lysate

Sign In for Pricing
View Details
NOX1 Human Gene Knockout Kit (CRISPR)
KN210426BN 1 Kit

NOX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sertad1 Mouse Gene Knockout Kit (CRISPR)
KN515612 1 Kit

Sertad1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD1a (O10 + C1A/711), Biotin conjugate, 0.1mg/mL
BNCB0717-500 1x 500 µL

CD1a (O10 + C1A/711), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Streptavidin, CF®680R Conjugate
#29072 1x 1 mg

Streptavidin, CF®680R Conjugate

Sign In for Pricing
View Details