FLCN Peptide - C-terminal region
FLCN Peptide - C-terminal region
Product Specifications
Product Name Alternative
BHD, DKFZp547A118, FLCL, FLJ45004, FLJ99377, MGC17998, MGC23445
UniProt
Q8NFG4
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FLCN Rabbit Polyclonal Antibody (orb585046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_659434
Preservative
Lyophilized powder
AA Sequence
CLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6349928-01 0.1 mL
SOX11, NT (SOX11, Transcription factor SOX-11) (MaxLight 650)
Sign In for Pricing
View Details MBS6349928-02 5x 0.1 mL
SOX11, NT (SOX11, Transcription factor SOX-11) (MaxLight 650)
Sign In for Pricing
View Details 
GTR15148434 1 Vial
Lentiviral human CPSF4 shRNA (UAS) - Lentiviral human CPSF4 shRNA (UAS) (100)
Sign In for Pricing
View Details