FLCN Peptide - C-terminal region
FLCN Peptide - C-terminal region
Product Specifications
Product Name Alternative
BHD, DKFZp547A118, FLCL, FLJ45004, FLJ99377, MGC17998, MGC23445
UniProt
Q8NFG4
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FLCN Rabbit Polyclonal Antibody (orb585046) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_659434
Preservative
Lyophilized powder
AA Sequence
CLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
F6998-25B-PE 100 µL
FRK (Fyn-Related Kinase, GTK, IYK, Nuclear Tyrosine Protein Kinase RAK, Protein Tyrosine Kinase 5, PTK5, RAK, Tyrosine Protein Kinase FRK) (PE) discontinued
Sign In for Pricing
View Details 
SELENBP2-7998M 50 µg
Recombinant Mouse SELENBP2 Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details 
A1059-78A-ML490 100 µL
AIF (CT) (AIF, MGC111425, Programmed cell death protein 8, mitochondrial precursor, PDCD8) (MaxLight 490) discontinued
Sign In for Pricing
View Details