Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAXD Peptide - middle region

NAXD Peptide - middle region

Product Specifications

Product Name Alternative

CARKD, LP3298

UniProt

Q8IW45

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAXD Rabbit Polyclonal Antibody (orb325343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060680

Preservative

Lyophilized powder

AA Sequence

ILSNGQQVLVCSQEGSSRRCGGQGDLLSGSLGVLVHWALLAGPQKTNGGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mib1 Rabbit Polyclonal Antibody
AP54909SU-N 200 µL

mib1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACP4 Human qPCR Primer Pair (NM_033068)
HP216300 200 Reactions

ACP4 Human qPCR Primer Pair (NM_033068)

Sign In for Pricing
View Details
Uroc1 Mouse Gene Knockout Kit (CRISPR)
KN518752 1 Kit

Uroc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS632585 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Human TIMP-3 (Tissue Inhibitors of Metalloproteinase 3) ELISA Kit
E-EL-H1454-01 24 Tests

Human TIMP-3 (Tissue Inhibitors of Metalloproteinase 3) ELISA Kit

Sign In for Pricing
View Details
Human TIMP-3 (Tissue Inhibitors of Metalloproteinase 3) ELISA Kit
E-EL-H1454-02 48 Tests

Human TIMP-3 (Tissue Inhibitors of Metalloproteinase 3) ELISA Kit

Sign In for Pricing
View Details