Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAXD Peptide - middle region

NAXD Peptide - middle region

Product Specifications

Product Name Alternative

CARKD, LP3298

UniProt

Q8IW45

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAXD Rabbit Polyclonal Antibody (orb325343) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060680

Preservative

Lyophilized powder

AA Sequence

ILSNGQQVLVCSQEGSSRRCGGQGDLLSGSLGVLVHWALLAGPQKTNGGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SECTM1 (NM_003004) Human Over-expression Lysate
LY418959 100 µg

SECTM1 (NM_003004) Human Over-expression Lysate

Sign In for Pricing
View Details
Bim (BCL2L11) pSer69/65 Rabbit Polyclonal Antibody
AP02527PU-N 100 µL

Bim (BCL2L11) pSer69/65 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Col6a1 Mouse Gene Knockout Kit (CRISPR)
KN503646 1 Kit

Col6a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prostate Specific Antigen (KLK3) (NM_001648) Human Over-expression Lysate
LY419823 100 µg

Prostate Specific Antigen (KLK3) (NM_001648) Human Over-expression Lysate

Sign In for Pricing
View Details
ACTC1 Rabbit Polyclonal Antibody
TA370157 100 µL

ACTC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4930433I11Rik Mouse Gene Knockout Kit (CRISPR)
KN500364 1 Kit

4930433I11Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details