Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTSJD1 Peptide - middle region

FTSJD1 Peptide - middle region

Product Specifications

Product Name Alternative

AFT, MTr2, FTSJD1

UniProt

Q8IYT2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FTSJD1 Rabbit Polyclonal Antibody (orb326164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060818

Preservative

Lyophilized powder

AA Sequence

TKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphotyrosine (P-Tyr) (PY265), CF405S conjugate, 0.1mg/mL
BNC040265-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY265), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZKSCAN1 Mouse Monoclonal Antibody [Clone ID: OTI1E4]
CF810936 100 µg

ZKSCAN1 Mouse Monoclonal Antibody [Clone ID: OTI1E4]

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF647 conjugate, 0.1mg/mL
BNC471824-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS703873 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
TRAPPC1 (NM_001166621) Human Over-expression Lysate
LY432581 100 µg

TRAPPC1 (NM_001166621) Human Over-expression Lysate

Sign In for Pricing
View Details
Molecular Sieves, 3A, Powder
TRC-M489003-500G 500 g

Molecular Sieves, 3A, Powder

Sign In for Pricing
View Details