Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTSJD1 Peptide - middle region

FTSJD1 Peptide - middle region

Product Specifications

Product Name Alternative

AFT, MTr2, FTSJD1

UniProt

Q8IYT2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FTSJD1 Rabbit Polyclonal Antibody (orb326164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060818

Preservative

Lyophilized powder

AA Sequence

TKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transmembrane protein 93 (EMC6) Human Gene Knockout Kit (CRISPR)
KN400938 1 Kit

Transmembrane protein 93 (EMC6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
trans-Linalool Oxide
TRC-L465975-25MG 25 mg

trans-Linalool Oxide

Sign In for Pricing
View Details
HIF-1 alpha (HIF1A) Goat Polyclonal Antibody
AB0070-100 300 µg

HIF-1 alpha (HIF1A) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Bim Recombinant Rabbit Monoclonal Antibody [SU0318]
ET1608-14 100 µL

Bim Recombinant Rabbit Monoclonal Antibody [SU0318]

Sign In for Pricing
View Details
CD99 / MIC2 (Ewing's Sarcoma Marker), Biotin conjugate, 0.1mg/mL
BNCB1646-100 1x 100 µL

CD99 / MIC2 (Ewing's Sarcoma Marker), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Cervix
CR561343 5 µg

Tissue Total RNA, Cervix

Sign In for Pricing
View Details