Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ30934 Peptide - middle region

FLJ30934 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp761P1320, MGC42112, MGC57276, SNX6B, FLJ30934

UniProt

Q86XE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLJ30934 Rabbit Polyclonal Antibody (orb326003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689973

Preservative

Lyophilized powder

AA Sequence

SLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neprilysin / NEP (MME) Antibody
abx228696-01 25 µg

Neprilysin / NEP (MME) Antibody

Sign In for Pricing
View Details
Neprilysin / NEP (MME) Antibody
abx228696-02 100 µg

Neprilysin / NEP (MME) Antibody

Sign In for Pricing
View Details
Neprilysin / NEP (MME) Antibody
abx228696-03 1 mg

Neprilysin / NEP (MME) Antibody

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) WEL3 Polyclonal Antibody
MBS9010917 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) WEL3 Polyclonal Antibody

Sign In for Pricing
View Details
Hepatitis B Surface Antigen (HBsAg) (MaxLight 405) discontinued
H1910-24A-ML405 100 µL

Hepatitis B Surface Antigen (HBsAg) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Swt1 shRNA (UAS) - Lentiviral mouse Swt1 shRNA (UAS, RFP) plasmid
GTR15195805 1 Vial

Lentiviral mouse Swt1 shRNA (UAS) - Lentiviral mouse Swt1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details