Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ30934 Peptide - middle region

FLJ30934 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp761P1320, MGC42112, MGC57276, SNX6B, FLJ30934

UniProt

Q86XE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLJ30934 Rabbit Polyclonal Antibody (orb326003) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689973

Preservative

Lyophilized powder

AA Sequence

SLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA E Rabbit Polyclonal Antibody (BF350)
orb1576214 100 µL

HLA E Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Mouse growth hormone releasing peptide-Ghrelin (GHRP-GHrelin) ELISA Kit
YP-W20615-01 48 Tests

Mouse growth hormone releasing peptide-Ghrelin (GHRP-GHrelin) ELISA Kit

Sign In for Pricing
View Details
Mouse growth hormone releasing peptide-Ghrelin (GHRP-GHrelin) ELISA Kit
YP-W20615-02 96 Tests

Mouse growth hormone releasing peptide-Ghrelin (GHRP-GHrelin) ELISA Kit

Sign In for Pricing
View Details
Phospho-CBL (Ser669) Recombinant Antibody, Cy5 Conjugated
bsm-61355R-Cy5-01 20 µL

Phospho-CBL (Ser669) Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Phospho-CBL (Ser669) Recombinant Antibody, Cy5 Conjugated
bsm-61355R-Cy5-02 100 µL

Phospho-CBL (Ser669) Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Rabbit Anti-Human Connexin 31.3 Polyclonal Antibody
PA89423HU-01 50 µg

Rabbit Anti-Human Connexin 31.3 Polyclonal Antibody

Sign In for Pricing
View Details