Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ30934 Peptide - middle region

FLJ30934 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp761P1320, MGC42112, MGC57276, SNX6B, FLJ30934

UniProt

Q86XE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLJ30934 Rabbit Polyclonal Antibody (orb326004) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689973

Preservative

Lyophilized powder

AA Sequence

ALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR4 Human Gene Knockout Kit (CRISPR)
KN204230BN 1 Kit

FGFR4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GM CSF Receptor alpha (CSF2RA) (NM_001161531) Human Over-expression Lysate
LY431354 100 µg

GM CSF Receptor alpha (CSF2RA) (NM_001161531) Human Over-expression Lysate

Sign In for Pricing
View Details
o-Anisidine-d3
TRC-A673523-10MG 10 mg

o-Anisidine-d3

Sign In for Pricing
View Details
RNF139 Rabbit Polyclonal Antibody
TA371486 100 µL

RNF139 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HNF4 gamma (HNF4G) (NM_004133) Human Over-expression Lysate
LY418192 100 µg

HNF4 gamma (HNF4G) (NM_004133) Human Over-expression Lysate

Sign In for Pricing
View Details
M6A Polyclonal Antibody
E-AB-40550-01 25 µL

M6A Polyclonal Antibody

Sign In for Pricing
View Details