Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ30934 Peptide - middle region

FLJ30934 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp761P1320, MGC42112, MGC57276, SNX6B, FLJ30934

UniProt

Q86XE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLJ30934 Rabbit Polyclonal Antibody (orb326004) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689973

Preservative

Lyophilized powder

AA Sequence

ALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perazine Dihydrochloride
TRC-P285800-10MG 10 mg

Perazine Dihydrochloride

Sign In for Pricing
View Details
Annexin V, CF®660R Conjugate
#29069 1x 500 µL

Annexin V, CF®660R Conjugate

Sign In for Pricing
View Details
LAT3 (SLC43A1) Human Gene Knockout Kit (CRISPR)
KN400563 1 Kit

LAT3 (SLC43A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SDCCAG10 (CWC27) Human Gene Knockout Kit (CRISPR)
KN423566 1 Kit

SDCCAG10 (CWC27) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant PCBP1 Antibody
RC-16297-01 50 μL

Recombinant PCBP1 Antibody

Sign In for Pricing
View Details
Recombinant PCBP1 Antibody
RC-16297-02 100 µL

Recombinant PCBP1 Antibody

Sign In for Pricing
View Details