Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ36070 Peptide - N-terminal region

FLJ36070 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ36070, MASTR, MGC117259

UniProt

Q6ZN01

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLJ36070 Rabbit Polyclonal Antibody (orb326039) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872380

Preservative

Lyophilized powder

AA Sequence

QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB2 Antibody - middle region (ARP74809_P050)
ARP74809_P050 100 µL

SERPINB2 Antibody - middle region (ARP74809_P050)

Sign In for Pricing
View Details
Mouse Serpinf1 Pre-designed siRNA Set B
SI112743B 1 Each

Mouse Serpinf1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
THAP12 Antibody
MBS8595784-01 0.1 mg

THAP12 Antibody

Sign In for Pricing
View Details
THAP12 Antibody
MBS8595784-02 0.1 mL (AF405L)

THAP12 Antibody

Sign In for Pricing
View Details
THAP12 Antibody
MBS8595784-03 0.1 mL (AF405S)

THAP12 Antibody

Sign In for Pricing
View Details
THAP12 Antibody
MBS8595784-04 0.1 mL (AF610)

THAP12 Antibody

Sign In for Pricing
View Details