Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ36070 Peptide - N-terminal region

FLJ36070 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ36070, MASTR, MGC117259

UniProt

Q6ZN01

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLJ36070 Rabbit Polyclonal Antibody (orb326039) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872380

Preservative

Lyophilized powder

AA Sequence

QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PAFAH2 Protein, N-His
E55P2904 50 µg

Recombinant Human PAFAH2 Protein, N-His

Sign In for Pricing
View Details
Rabbit anti-QSER1 Antibody, Affinity Purified
MBS3902504-01 0.01 mg

Rabbit anti-QSER1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-QSER1 Antibody, Affinity Purified
MBS3902504-02 0.1 mg

Rabbit anti-QSER1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-QSER1 Antibody, Affinity Purified
MBS3902504-03 5x 0.01 mg

Rabbit anti-QSER1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-QSER1 Antibody, Affinity Purified
MBS3902504-04 5x 0.1 mg

Rabbit anti-QSER1 Antibody, Affinity Purified

Sign In for Pricing
View Details
CD1d Rabbit Polyclonal Antibody (BF680)
orb1608948 100 µL

CD1d Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details