FLJ43806 Peptide - C-terminal region
FLJ43806 Peptide - C-terminal region
Product Specifications
Product Name Alternative
KAZ, FLJ10199, FLJ32593, FLJ43398, FLJ43806, KIAA1026, MGC126686, MGC142181, RP1-21O18.1, DKFZp686D08115
UniProt
Q674X7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FLJ43806 Rabbit Polyclonal Antibody (orb326412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_963922
Preservative
Lyophilized powder
AA Sequence
ASSVTRAGKEENSSGLKYKAGRLPLGKIGRGFSSKDPDFHDDYGSLQNED
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040040-500 1x 500 µL
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550633-500 1x 500 µL
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 