Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLYWCH1 Peptide - C-terminal region

FLYWCH1 Peptide - C-terminal region

Product Specifications

UniProt

Q4VC44

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLYWCH1 Rabbit Polyclonal Antibody (orb584684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115672

Preservative

Lyophilized powder

AA Sequence

ARMGCRSRAITQGRRVTVMRGHCHPPDLGGLEALRQREKRPNTAQRGSPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mup7 ORF Vector (Mouse) (pORF)
31169014 1.0 µg DNA

Mup7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Monoclonal GPHA2 Antibody (064) [PerCP]
NBP2-90250PCP 0.1 mL

Rabbit Monoclonal GPHA2 Antibody (064) [PerCP]

Sign In for Pricing
View Details
Human PNRC2 Recombinant Protein
PROTQ9NPJ4-100ug 100 µg

Human PNRC2 Recombinant Protein

Sign In for Pricing
View Details
ABCG8 Lentiviral Activation Particles (m2)
sc-426583-LAC-2 200 µL

ABCG8 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Mug1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7516903 1.0 µg DNA

Mug1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Ethyl 5-bromo-1H-imidazole-4-carboxylate
OR52419-01 250 mg

Ethyl 5-bromo-1H-imidazole-4-carboxylate

Sign In for Pricing
View Details