Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLYWCH1 Peptide - C-terminal region

FLYWCH1 Peptide - C-terminal region

Product Specifications

UniProt

Q4VC44

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLYWCH1 Rabbit Polyclonal Antibody (orb584684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115672

Preservative

Lyophilized powder

AA Sequence

ARMGCRSRAITQGRRVTVMRGHCHPPDLGGLEALRQREKRPNTAQRGSPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit
MBS7227085-01 48 Well

Rat CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit

Sign In for Pricing
View Details
Rat CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit
MBS7227085-02 96 Well

Rat CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit

Sign In for Pricing
View Details
Rat CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit
MBS7227085-03 5x 96 Well

Rat CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit

Sign In for Pricing
View Details
Rat CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit
MBS7227085-04 10x 96 Well

Rat CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit

Sign In for Pricing
View Details
CXCL12 Antibody
orb2682528-01 50 µL

CXCL12 Antibody

Sign In for Pricing
View Details
CXCL12 Antibody
orb2682528-02 100 µL

CXCL12 Antibody

Sign In for Pricing
View Details