Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLYWCH1 Peptide - middle region

FLYWCH1 Peptide - middle region

Product Specifications

UniProt

Q4VC44

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLYWCH1 Rabbit Polyclonal Antibody (orb584685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115672

Preservative

Lyophilized powder

AA Sequence

RDHALHGCRSRAITQGQRVTVMRGHCHQPDMEGLEARRQQEKAVETLQAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 2E1 (CYP2E1) (NM_000773) Human Recombinant Protein
TP313502 20 µg

Cytochrome P450 2E1 (CYP2E1) (NM_000773) Human Recombinant Protein

Sign In for Pricing
View Details
PKC mu (PRKD1) Rabbit Polyclonal Antibody
AP02657PU-S 50 µL

PKC mu (PRKD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ViPrimePLUS AtTaq qPCR Green Master Mix II, 150rxns
QLMM07 150 Reactions

ViPrimePLUS AtTaq qPCR Green Master Mix II, 150rxns

Sign In for Pricing
View Details
Enprofylline
TRC-E557680-10MG 10 mg

Enprofylline

Sign In for Pricing
View Details
Cesium fluoride
TRC-C280005-1G 1 g

Cesium fluoride

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS702851 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details