Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLYWCH1 Peptide - middle region

FLYWCH1 Peptide - middle region

Product Specifications

UniProt

Q4VC44

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FLYWCH1 Rabbit Polyclonal Antibody (orb584685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115672

Preservative

Lyophilized powder

AA Sequence

RDHALHGCRSRAITQGQRVTVMRGHCHQPDMEGLEARRQQEKAVETLQAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vertical Autoclave BAVT-3303
BAVT-3303 1 Unit

Vertical Autoclave BAVT-3303

Sign In for Pricing
View Details
7-Hydroxyquinoline
TRC-H954208-2.5G 2.5 g

7-Hydroxyquinoline

Sign In for Pricing
View Details
Ucp1 Mouse Gene Knockout Kit (CRISPR)
KN318648 1 Kit

Ucp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uhrf1bp1l Mouse Gene Knockout Kit (CRISPR)
KN518687 1 Kit

Uhrf1bp1l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS802146 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Ankdd1b Mouse Gene Knockout Kit (CRISPR)
KN501250 1 Kit

Ankdd1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details