Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fmo3 Peptide - middle region

Fmo3 Peptide - middle region

Product Specifications

Product Name Alternative

AW111792

UniProt

Q8VHG0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fmo3 Rabbit Polyclonal Antibody (orb579171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032056

Preservative

Lyophilized powder

AA Sequence

KPNVKEFTETSAVFEDGTMFEAIDCVIFATGYGYAYPFLDDSIIKSRNNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (Thyroidal Cell Marker) (r2H11), 0.2mg/mL
BNUB2161-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (r2H11), 0.2mg/mL

Sign In for Pricing
View Details
Boc-D-serine
TRC-B667350-1G 1 g

Boc-D-serine

Sign In for Pricing
View Details
3-[[2-[(2-Chloroethyl)amino]ethyl]amino]propyl Monophosphate Dihydrochloride
TRC-C364250-25MG 25 mg

3-[[2-[(2-Chloroethyl)amino]ethyl]amino]propyl Monophosphate Dihydrochloride

Sign In for Pricing
View Details
ROCK1 Rabbit Polyclonal Antibody
AP20652PU-N 100 µg

ROCK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IRF3 Recombinant Rabbit Monoclonal Antibody [SD2062]
ET1612-14 100 µL

IRF3 Recombinant Rabbit Monoclonal Antibody [SD2062]

Sign In for Pricing
View Details
Caspase-6 Antibody
F43295-0.08ML 0.08 mL

Caspase-6 Antibody

Sign In for Pricing
View Details