FMO3 Peptide - N-terminal region
FMO3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FMOII, MGC34400, dJ127D3.1, TMAU
UniProt
P31513
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FMO3 Rabbit Polyclonal Antibody (orb579169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001002294
Preservative
Lyophilized powder
AA Sequence
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC050017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880270-500 1x 500 µL
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details