Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fmr1 Peptide - C-terminal region

Fmr1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FMRP, Fmr1

UniProt

Q80WE1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fmr1 Rabbit Polyclonal Antibody (orb330125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_434691

Preservative

Lyophilized powder

AA Sequence

QIGASSRPPPNRTDKEKGYVTDDGQGMGRGSRPYRNRGHGRRGPGYTSES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MiTF (Microphthalmia Transcription Factor) (C5/D5), 0.2mg/mL
BNUB0892-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Testis
CS707706 5x 5 µm

Tissue FFPE Sections, Testis

Sign In for Pricing
View Details
Vitexin
TRC-V757000-25MG 25 mg

Vitexin

Sign In for Pricing
View Details
EGFR Rabbit Polyclonal Antibody
R1511-18 100 µL

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Atg16l2 Mouse Gene Knockout Kit (CRISPR)
KN501732 1 Kit

Atg16l2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hexadecyl Bromoacetate-13C2
TRC-H293722-25MG 25 mg

Hexadecyl Bromoacetate-13C2

Sign In for Pricing
View Details