Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fmr1 Peptide - C-terminal region

Fmr1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FMRP, Fmr1

UniProt

Q80WE1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fmr1 Rabbit Polyclonal Antibody (orb330125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_434691

Preservative

Lyophilized powder

AA Sequence

QIGASSRPPPNRTDKEKGYVTDDGQGMGRGSRPYRNRGHGRRGPGYTSES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPPDE1 (DESI2) Human Gene Knockout Kit (CRISPR)
KN402524 1 Kit

PPPDE1 (DESI2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Ptprc activation kit by CRISPRa
GA203486 1 Kit

Mouse Ptprc activation kit by CRISPRa

Sign In for Pricing
View Details
ZSCAN4 Human Gene Knockout Kit (CRISPR)
KN211003BN 1 Kit

ZSCAN4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PECI (ECI2) (NM_001166010) Human Over-expression Lysate
LC431874 20 µg

PECI (ECI2) (NM_001166010) Human Over-expression Lysate

Sign In for Pricing
View Details
RCBTB2 (NM_001286831) Human Tagged ORF Clone
RG238726 10 µg

RCBTB2 (NM_001286831) Human Tagged ORF Clone

Sign In for Pricing
View Details
USP39 (NM_006590) Human Over-expression Lysate
LC401972 20 µg

USP39 (NM_006590) Human Over-expression Lysate

Sign In for Pricing
View Details