Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxa2 Peptide - C-terminal region

Foxa2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HNF3-beta, HNF3beta, Hnf-3b, Hnf3b, Tcf-3b, Tcf3b

UniProt

P35583

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxa2 Rabbit Polyclonal Antibody (orb576193) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034576

Preservative

Lyophilized powder

AA Sequence

VDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATVKRAKLQDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERGIC2 Protein Vector (Human) (pPM-C-HA)
19420022 500 ng

ERGIC2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Adenosine- 2', 3'- cyclic monophosphorothioate, endo / Rp- isomer (Rp-2',3'-cAMPS), sodium salt
A 006-05 5 µmol (~ 1.9 mg)

Adenosine- 2', 3'- cyclic monophosphorothioate, endo / Rp- isomer (Rp-2',3'-cAMPS), sodium salt

Sign In for Pricing
View Details
Polymyxin P2
TN11030-01 10 mg

Polymyxin P2

Sign In for Pricing
View Details
Polymyxin P2
TN11030-02 50 mg

Polymyxin P2

Sign In for Pricing
View Details
ABCC2 Knockout NCI-H1299 Polyclonal Cells
ARG30157 1 Million

ABCC2 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
NONO (NM_001145409) Human Tagged ORF Clone Lentiviral Particle
RC226579L3V 200 µL

NONO (NM_001145409) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details