Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxb2 Peptide - C-terminal region

Foxb2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Fkh4

UniProt

Q64733

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxb2 Rabbit Polyclonal Antibody (orb576125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032049

Preservative

Lyophilized powder

AA Sequence

FGVPVKALCHSANQSLPAVPVPIKPTPALPPVTTLPPALSVPTASQQLPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N Cadherin/CDH2 Rabbit Polyclonal Antibody (FITC)
orb2603184 100 µg

N Cadherin/CDH2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Reactive Blue 4
T19051-01 1 mL - 10 mM (in DMSO)

Reactive Blue 4

Sign In for Pricing
View Details
Reactive Blue 4
T19051-02 2 g

Reactive Blue 4

Sign In for Pricing
View Details
PLLP Protein Vector (Human) (pPM-C-His)
PV031760 500 ng

PLLP Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
1- (Chloromethyl) -4-ethoxybenzene
GAA65380-01 1 g

1- (Chloromethyl) -4-ethoxybenzene

Sign In for Pricing
View Details
1- (Chloromethyl) -4-ethoxybenzene
GAA65380-02 10 g

1- (Chloromethyl) -4-ethoxybenzene

Sign In for Pricing
View Details