Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxb2 Peptide - C-terminal region

Foxb2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Fkh4

UniProt

Q64733

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxb2 Rabbit Polyclonal Antibody (orb576125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032049

Preservative

Lyophilized powder

AA Sequence

FGVPVKALCHSANQSLPAVPVPIKPTPALPPVTTLPPALSVPTASQQLPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE1 siRNA (Rat)
CRR1122-01 15 nmol

BACE1 siRNA (Rat)

Sign In for Pricing
View Details
BACE1 siRNA (Rat)
CRR1122-02 30 nmol

BACE1 siRNA (Rat)

Sign In for Pricing
View Details
POTE-E (POTE Ankyrin Domain Family Member E) BioAssayTM ELISA Kit (Human) discontinued
358247-01 48 Tests

POTE-E (POTE Ankyrin Domain Family Member E) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
POTE-E (POTE Ankyrin Domain Family Member E) BioAssayTM ELISA Kit (Human) discontinued
358247-02 96 Tests

POTE-E (POTE Ankyrin Domain Family Member E) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Myc-Tag (c-myc, myc-1 epitope tag) (MaxLight 650) discontinued
031143-ML650 100 µL

Myc-Tag (c-myc, myc-1 epitope tag) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Arl-6 Antibody
orb799304 2 mg

Arl-6 Antibody

Sign In for Pricing
View Details