Foxc1 Peptide - N-terminal region
Foxc1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FREAC3, Fkh1, Mf1, Mf4, ch, fkh-1, frkhda
UniProt
Q9QWR9
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Foxc1 Rabbit Polyclonal Antibody (orb329892) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032618
Preservative
Lyophilized powder
AA Sequence
MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM040578 100 µg
Recombinant Mouse SerpinB3/SCCA1 Protein (His Tag)
Sign In for Pricing
View Details 
![ARTS1 (ERAP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G4]](https://cdn.genprice.uk/products/937/68dd1b87061270361ea20f8c/imageurl/ta812887am.webp)
TA812887AM 100 µL
ARTS1 (ERAP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G4]
Sign In for Pricing
View Details 