Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxc1 Peptide - N-terminal region

Foxc1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FREAC3, Fkh1, Mf1, Mf4, ch, fkh-1, frkhda

UniProt

Q9QWR9

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxc1 Rabbit Polyclonal Antibody (orb329892) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032618

Preservative

Lyophilized powder

AA Sequence

MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse SerpinB3/SCCA1 Protein (His Tag)
PKSM040578 100 µg

Recombinant Mouse SerpinB3/SCCA1 Protein (His Tag)

Sign In for Pricing
View Details
Mouse Col8a1 activation kit by CRISPRa
GA200825 1 Kit

Mouse Col8a1 activation kit by CRISPRa

Sign In for Pricing
View Details
ARTS1 (ERAP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G4]
TA812887AM 100 µL

ARTS1 (ERAP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G4]

Sign In for Pricing
View Details
Recombinant PARP1 Antibody
RC-16754-01 50 μL

Recombinant PARP1 Antibody

Sign In for Pricing
View Details
Recombinant PARP1 Antibody
RC-16754-02 100 µL

Recombinant PARP1 Antibody

Sign In for Pricing
View Details
Recombinant PARP1 Antibody
RC-16754-03 1 mL

Recombinant PARP1 Antibody

Sign In for Pricing
View Details