Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxc1 Peptide - N-terminal region

Foxc1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FREAC3, Fkh1, Mf1, Mf4, ch, fkh-1, frkhda

UniProt

Q9QWR9

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxc1 Rabbit Polyclonal Antibody (orb329892) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032618

Preservative

Lyophilized powder

AA Sequence

MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIL 2R Human
OM296359-01 25 µg

SIL 2R Human

Sign In for Pricing
View Details
SIL 2R Human
OM296359-02 5 µg

SIL 2R Human

Sign In for Pricing
View Details
SIL 2R Human
OM296359-03 1 mg

SIL 2R Human

Sign In for Pricing
View Details
CD4 (C4/206), CF640R conjugate, 0.1mg/mL
BNC400206-500 1x 500 µL

CD4 (C4/206), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Quercetin 3-O-(6''-O-Malonyl)-β-D-glucoside
TRC-Q510035-5MG 5 mg

Quercetin 3-O-(6''-O-Malonyl)-β-D-glucoside

Sign In for Pricing
View Details
SRPR beta (SRPRB) (NM_021203) Human Over-expression Lysate
LY402853 100 µg

SRPR beta (SRPRB) (NM_021203) Human Over-expression Lysate

Sign In for Pricing
View Details