Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxc2 Peptide - N-terminal region

Foxc2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Fkh14, Hfhbf3, MFH-1, Mfh1

UniProt

Q61850

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxc2 Rabbit Polyclonal Antibody (orb330095) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038547

Preservative

Lyophilized powder

AA Sequence

GMGRSYAPYHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: left
CS809418 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
GABA A Receptor alpha 6 (GABRA6) Human Gene Knockout Kit (CRISPR)
KN423410 1 Kit

GABA A Receptor alpha 6 (GABRA6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
D-a-Tocopherol Quinone
TRC-T526210-1G 1 g

D-a-Tocopherol Quinone

Sign In for Pricing
View Details
FITC Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041C-01 20 Tests

FITC Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
FITC Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041C-02 100 Tests

FITC Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details
FITC Anti-Human CD5 Antibody[UCHT2]
E-AB-F1041C-03 2x 100 Tests

FITC Anti-Human CD5 Antibody[UCHT2]

Sign In for Pricing
View Details