Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxc2 Peptide - N-terminal region

Foxc2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Fkh14, Hfhbf3, MFH-1, Mfh1

UniProt

Q61850

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxc2 Rabbit Polyclonal Antibody (orb330095) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038547

Preservative

Lyophilized powder

AA Sequence

GMGRSYAPYHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF405S conjugate, 0.1mg/mL
BNC041948-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BTK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A2]
TA501094BM 100 µL

BTK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A2]

Sign In for Pricing
View Details
Nor Cholic Acid
TRC-N661440-250MG 250 mg

Nor Cholic Acid

Sign In for Pricing
View Details
Nkx2.5 (NKX2-5) (NM_004387) Human Over-expression Lysate
LC401397 20 µg

Nkx2.5 (NKX2-5) (NM_004387) Human Over-expression Lysate

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF568 conjugate, 0.1mg/mL
BNC682984-500 1x 500 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Mouse CD1d Antibody[19G11]
E-AB-F1032UE-01 25 µg

APC Anti-Mouse CD1d Antibody[19G11]

Sign In for Pricing
View Details