Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxd2 Peptide - C-terminal region

Foxd2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Mf2, AI426778

UniProt

O35392

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxd2 Rabbit Polyclonal Antibody (orb329893) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032619

Preservative

Lyophilized powder

AA Sequence

GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endophilin B1 (SH3 Domain-containing GRB2-like Protein B1, Bax-interacting Factor 1, Bif-1, SH3GLB1, KIAA0491, CGI-61) discontinued
S1013-31K7 50 µg

Endophilin B1 (SH3 Domain-containing GRB2-like Protein B1, Bax-interacting Factor 1, Bif-1, SH3GLB1, KIAA0491, CGI-61) discontinued

Sign In for Pricing
View Details
RELM beta Rabbit Polyclonal Antibody (APC-Cy7)
orb2408755 100 µL

RELM beta Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Recombinant Human Calcitonin gene-related peptide 1 (CALCA), partial
orb2658121-01 20 µg

Recombinant Human Calcitonin gene-related peptide 1 (CALCA), partial

Sign In for Pricing
View Details
Recombinant Human Calcitonin gene-related peptide 1 (CALCA), partial
orb2658121-02 100 µg

Recombinant Human Calcitonin gene-related peptide 1 (CALCA), partial

Sign In for Pricing
View Details
Recombinant Human Calcitonin gene-related peptide 1 (CALCA), partial
orb2658121-03 1 mg

Recombinant Human Calcitonin gene-related peptide 1 (CALCA), partial

Sign In for Pricing
View Details
IgG, F(ab')2 (Texas Red)
MBS621374-01 2 mg

IgG, F(ab')2 (Texas Red)

Sign In for Pricing
View Details