Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxd2 Peptide - C-terminal region

Foxd2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Mf2, AI426778

UniProt

O35392

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxd2 Rabbit Polyclonal Antibody (orb329893) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032619

Preservative

Lyophilized powder

AA Sequence

GPGGQAQVLAMLTAPALTPVAGHIRLSHPGDSLLSSGPSFASKVAGLSGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNCB Protein Vector (Human) (pPB-C-His)
PV130638 500 ng

SNCB Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
hsa-miR-1179 miRNA Agomir
MBS8311429-01 5 nmol

hsa-miR-1179 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-1179 miRNA Agomir
MBS8311429-02 10 nmol

hsa-miR-1179 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-1179 miRNA Agomir
MBS8311429-03 20 nmol

hsa-miR-1179 miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-1179 miRNA Agomir
MBS8311429-04 5x 20 nmol

hsa-miR-1179 miRNA Agomir

Sign In for Pricing
View Details
Lentiviral mouse Slc6a20b shRNA (UAS) - Lentiviral mouse Slc6a20b shRNA (UAS, iRFP) plasmid
GTR15260176 1 Vial

Lentiviral mouse Slc6a20b shRNA (UAS) - Lentiviral mouse Slc6a20b shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details