Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxd4 Peptide - N-terminal region

Foxd4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FREAC5, Fkh2

UniProt

Q60688

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxd4 Rabbit Polyclonal Antibody (orb576124) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032048

Preservative

Lyophilized powder

AA Sequence

MNSARAGHLRSTPPPSPLSSDQDEVEIDVLAEEEDGDQTEEEDDEEESHK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-[3-chloro-3- (4-chlorophenyl) prop-2-enylidene]malononitrile
OR26550 1 Each

2-[3-chloro-3- (4-chlorophenyl) prop-2-enylidene]malononitrile

Sign In for Pricing
View Details
MAGIX rabbit pAb Antibody
orb2304682-01 50 µL

MAGIX rabbit pAb Antibody

Sign In for Pricing
View Details
MAGIX rabbit pAb Antibody
orb2304682-02 100 µL

MAGIX rabbit pAb Antibody

Sign In for Pricing
View Details
Olr705 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7161608 1.0 µg DNA

Olr705 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Glutathione Synthetase (GSS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]
TA502094BM 100 µL

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B8]

Sign In for Pricing
View Details
Mouse Anyi-PDL1 ELISA Kit
EKU12953 96 Tests

Mouse Anyi-PDL1 ELISA Kit

Sign In for Pricing
View Details