Foxf1a Peptide - middle region
Foxf1a Peptide - middle region
Product Specifications
Product Name Alternative
AI450827, FREAC1, Foxf1, Freac-1, HFH-8, Hfh8, Foxf1a
UniProt
Q61080
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Foxf1a Rabbit Polyclonal Antibody (orb324679) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IHC, WB
NCBI Accession Number
NP_034556
Preservative
Lyophilized powder
AA Sequence
GCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A0004-02Z3 100 µg
ABCB10 (ABCB10 ATP Binding Cassette, Sub-family B (MDR/TAP) Member 10, ATP-binding Cassette Sub-family B Member 10 Mitochondrial, ABCB 10, ATP-binding Cassette Transporter 10, ABC Transporter 10 Protein, EST20237, Mitochondrial ATP Binding Cassette 2, M ABC2, M-ABC2, MTABC2) discontinued
Sign In for Pricing
View Details 
GTR15134011 1 Vial
Lentiviral mouse Cts8 shRNA (UAS) - Lentiviral mouse Cts8 shRNA (UAS) plasmid
Sign In for Pricing
View Details