Foxf1a Peptide - middle region
Foxf1a Peptide - middle region
Product Specifications
Product Name Alternative
AI450827, FREAC1, Foxf1, Freac-1, HFH-8, Hfh8, Foxf1a
UniProt
Q61080
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Foxf1a Rabbit Polyclonal Antibody (orb324679) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IHC, WB
NCBI Accession Number
NP_034556
Preservative
Lyophilized powder
AA Sequence
GCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS650090-01 0.01 mg
TRAIL, Recombinant, Human (TNF-Related Apoptosis Inducing Ligand, Apo2L, TL2, TNFSF10)
Sign In for Pricing
View Details MBS650090-02 0.05 mg
TRAIL, Recombinant, Human (TNF-Related Apoptosis Inducing Ligand, Apo2L, TL2, TNFSF10)
Sign In for Pricing
View Details MBS650090-03 5x 0.05 mg
TRAIL, Recombinant, Human (TNF-Related Apoptosis Inducing Ligand, Apo2L, TL2, TNFSF10)
Sign In for Pricing
View Details 
