Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxi2 Peptide - C-terminal region

Foxi2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B130055A05Rik

UniProt

A2RTG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxi2 Rabbit Polyclonal Antibody (orb329929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_899016

Preservative

Lyophilized powder

AA Sequence

FDNGNFRRKRRRRGETSEAAVPGASSPEGTALEPRGSTPQDPQTSPSPSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35F5 (NM_025181) Human Over-expression Lysate
LY403057 100 µg

SLC35F5 (NM_025181) Human Over-expression Lysate

Sign In for Pricing
View Details
Canine Integrin alpha 11 beta 1 (ITGA11&ITGB1) Heterodimer Protein, His Tag&Tag Free
IT1-C52W9-100ug 100 µg

Canine Integrin alpha 11 beta 1 (ITGA11&ITGB1) Heterodimer Protein, His Tag&Tag Free

Sign In for Pricing
View Details
CD180 Rabbit Polyclonal Antibody
ER2001-06 100 µL

CD180 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
p57 Kip2 (CDKN1C) Rabbit Polyclonal Antibody
TA374585 100 µL

p57 Kip2 (CDKN1C) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNAAF4 (NM_001033559) Human Over-expression Lysate
LY425569 100 µg

DNAAF4 (NM_001033559) Human Over-expression Lysate

Sign In for Pricing
View Details
SMTNL2 (NM_001114974) Human Over-expression Lysate
LY426513 100 µg

SMTNL2 (NM_001114974) Human Over-expression Lysate

Sign In for Pricing
View Details