Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxi2 Peptide - N-terminal region

Foxi2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B130055A05Rik

UniProt

A2RTG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxi2 Rabbit Polyclonal Antibody (orb329930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_899016

Preservative

Lyophilized powder

AA Sequence

AQAGGELDMAGFCDSLGSCSVPHGLTRAIAHPPSYGRTDLSSGRRLWVNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM29 Polyclonal Antibody
E-AB-12946-01 20 µL

ADAM29 Polyclonal Antibody

Sign In for Pricing
View Details
ADAM29 Polyclonal Antibody
E-AB-12946-02 60 µL

ADAM29 Polyclonal Antibody

Sign In for Pricing
View Details
ADAM29 Polyclonal Antibody
E-AB-12946-03 120 µL

ADAM29 Polyclonal Antibody

Sign In for Pricing
View Details
ADAM29 Polyclonal Antibody
E-AB-12946-04 200 µL

ADAM29 Polyclonal Antibody

Sign In for Pricing
View Details
Rnf222 Mouse Gene Knockout Kit (CRISPR)
KN514944 1 Kit

Rnf222 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PBK/TOPK Antibody
KC-26444-01 50 μL

PBK/TOPK Antibody

Sign In for Pricing
View Details