Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxi2 Peptide - N-terminal region

Foxi2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B130055A05Rik

UniProt

A2RTG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxi2 Rabbit Polyclonal Antibody (orb329930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_899016

Preservative

Lyophilized powder

AA Sequence

AQAGGELDMAGFCDSLGSCSVPHGLTRAIAHPPSYGRTDLSSGRRLWVNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10-Deoxo-9,10-dehydro Ketotifen
TRC-D231580-5MG 5 mg

10-Deoxo-9,10-dehydro Ketotifen

Sign In for Pricing
View Details
Tbc1d7 Mouse Gene Knockout Kit (CRISPR)
KN517258 1 Kit

Tbc1d7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RBM28 (NM_001166135) Human Over-expression Lysate
LY431533 100 µg

RBM28 (NM_001166135) Human Over-expression Lysate

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker), CF405S conjugate, 0.1mg/mL
BNC041774-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human KLHL14 activation kit by CRISPRa
GA111593 1 Kit

Human KLHL14 activation kit by CRISPRa

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2468), 1mg/mL
BNUM2468-50 1x 50 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2468), 1mg/mL

Sign In for Pricing
View Details