Foxj1 Peptide - middle region
Foxj1 Peptide - middle region
Product Specifications
Product Name Alternative
FKHL-13, HFH-4, Hfh4
UniProt
Q3US42
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Foxj1 Rabbit Polyclonal Antibody (orb576129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032266
Preservative
Lyophilized powder
AA Sequence
HPAFARQASQEPSAAPWGGPLTVNREAQQLLQEFEEATGEGGWGTGEGRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-UNEL-H0318-01 5x 96 Tests
Uncoated Human CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0318-02 15x 96 Tests
Uncoated Human CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit
Sign In for Pricing
View Details 
TRC-D195651-5MG 5 mg
Deacetamidine Cyano Dabigatran Ethyl Ester-13C6
Sign In for Pricing
View Details 
