Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxj1 Peptide - middle region

Foxj1 Peptide - middle region

Product Specifications

Product Name Alternative

FKHL-13, HFH-4, Hfh4

UniProt

Q3US42

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxj1 Rabbit Polyclonal Antibody (orb576446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032266

Preservative

Lyophilized powder

AA Sequence

YAERLLSGAFKKRRLPPVHIHPAFARQASQEPSAAPWGGPLTVNREAQQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Baculovirus Envelope gp64 protein Antibody (M001)
NBP3-05840-200ug 200 µg

Mouse Monoclonal Baculovirus Envelope gp64 protein Antibody (M001)

Sign In for Pricing
View Details
hsa-miR-4479 miRNA Inhibitor
MBS8294101-01 10 nmol

hsa-miR-4479 miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-4479 miRNA Inhibitor
MBS8294101-02 20 nmol

hsa-miR-4479 miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-4479 miRNA Inhibitor
MBS8294101-03 5x 20 nmol

hsa-miR-4479 miRNA Inhibitor

Sign In for Pricing
View Details
Human Hepatic lipase (HL) ELISA Kit
AE39915HU-01 48 Tests

Human Hepatic lipase (HL) ELISA Kit

Sign In for Pricing
View Details
Human Hepatic lipase (HL) ELISA Kit
AE39915HU-02 96 Tests

Human Hepatic lipase (HL) ELISA Kit

Sign In for Pricing
View Details